تبليغاتX
Click here to get your free mobile phone or apple ipod Lovely English

Lovely English

Those who know nothing of foreign languages, know noting of their own

Rare Spherical Planetary Nebula Abell 39

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

The simple spherical geometry of planetary nebula Abell 39 will help astronomers identify the source of very serious errors in measuring the chemical composition of dying stars"The truly spherical nature of this beautiful nebula helps us eliminate a common confusion concerning the actual three-dimensional geometry of most nebulae," says George Jacoby, director of the Wisconsin-Indiana-Yale-NOAO (WIYN) Observatory and co-author of a study with Gary Ferland of University of Kentucky and Kirk Korista of Western Michigan University.The butterfly-like shape of many nebulae, and filaments or clumps of dense gas within them, cause starlight to penetrate the nebulae unevenly, depending on the density and thickness of the clumps, as well as the distance of the gas from the star. Only in rare cases can the nebula's geometry be deduced from indirect measurements in order to model the interactions.As reported today in San Diego at the 197th meeting of the American Astronomical Society, researchers found that the star that produced Abell 39 had only half the amount of oxygen found in the Sun. This result is not especially unusual, because the Sun has a relatively enriched composition of heavy elements. But for some stars, the same sorts of analyses have yielded compositions that can disagree with each other by a factor of three or more."Such discrepancies are totally unsatisfactory for developing a detailed picture of how chemical elements were built up over time in our galaxy and in other parts of the Universe," Jacoby explains.Abell 39 is the 39th entry in a catalog of large nebulae discovered by astronomer George Abell in 1966. This image of it was taken at the WIYN Observatory's 3.5-meter (138-inch) telescope, through a blue-green filter that isolates the light emitted by oxygen atoms in the nebula at a wavelength of 500.7 nanometers.Unfortunately, Abell 39 is so faint that Jacoby and collaborators were unable to measure all the critical information from the nebula that is needed to isolate the cause of the composition measurement discrepancies, even though they used the National Science Foundation's Mayall 4-meter telescope at Kitt Peak National Observatory to collect spectral details. Instead, they provide their predictions of what they expected to measure, in order to guide future observers with more sensitive equipment and larger telescopes.The nebula has a diameter of about five light-years, and the thickness of the spherical shell is about a third of a light-year. Positioned in the constellation Hercules, the nebula is located roughly 7,000 light-years from Earth. Careful viewing of the image shows that the "central" star is off-center to the right by a small amount (less than a tenth of a light-year.) The cause of this shift is unknown. Furthermore, the very faint glow barely visible around the brightest part of the nebula is evidence for a larger halo surrounding the main body. As a curiosity, several distant galaxies can be seen right through the nebula and just outside of it 

Mon 20 Jul 2009 |

Too long names

Wales (country that is part of the United Kingdom), there is a village called Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (58 letters), which in English means "Saint Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave." The locals call it Llanfairpwll. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word .com domain name in the world. However in October 1999, it became possible to register domain names up to 67 characters in and finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronuku

pokaiwhenuaakitanarahu

Which translates into English as "The brow of the hill where Tamatea, with the bony knees, who slid and climbed mountains, the great travelers, sat and played on the flute to his beloved
This town is in New Zealand with
a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

In Thailand which is long so long that it doesn't even fit on one line! Meaning the 'City of Angels' (a whopping 163 characters), is known to the locals as Krungthep Mahanakhon. However, it is not recognised by the Guinness Book of Records

However whilst the New Zealand place name is recognised by the Guinness Book of Record, the Thailand name is not

Tue 23 Jun 2009 |
anonymous

Hello my friends.I'm an English nut & I've made this weblog to make better my and your English .I want you to tell your suggestions in English. If you don’t tell English suggestions I won't accept them So PLEASE TELL ENGLISH SUGGESTIONS

anonymous0731@yahoo.com

Topics

DAILY WORDS

Small Thinkable Sentences

Silverstein

Alfred Nobel

Astronomy

Antarctic

Interesting Facts

Last Writings

Nori ta Abadiyat (The Words I LOVE YOU

Hubble Servicing Mission 4 Early Release Observations

Astronomers Find Hyperactive Galaxies in the Early Universe

Rare Spherical Planetary Nebula Abell 39

Too long names

NGC 1333

collocations of astronomy

Alfred Nobel

DAILY WORDS